PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009148641.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 400aa    MW: 46033.3 Da    PI: 7.1358
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009148641.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix88.48e-2881162286
        trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     W ++e++ Li +rr m+  ++++k++k+lWee+s+kmre+gf rsp++C++kw+nl k+ykk k++++++   +s +++y++++e
  XP_009148641.1  81 WVQDETRSLIMFRRGMDGLFNTSKSNKHLWEEISAKMREKGFDRSPTMCTDKWRNLLKEYKKAKHHDRGN---VSAKMSYYKEIE 162
                     ********************************************************************95...77889****998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-471142IPR009057Homeodomain-like
PROSITE profilePS500908.07273137IPR017877Myb-like domain
SMARTSM007170.009577139IPR001005SANT/Myb domain
CDDcd122036.03E-3179144No hitNo description
PfamPF138371.1E-2080163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MFVSDKPRPN DFYKDDNTNS STAARNMIID GDLQPHNHHP HHNHNHNHHH HNHLQPQQIL  60
LGESSGEDHE VKAPKKRAET WVQDETRSLI MFRRGMDGLF NTSKSNKHLW EEISAKMREK  120
GFDRSPTMCT DKWRNLLKEY KKAKHHDRGN VSAKMSYYKE IEDILRERSK KVTTQYSKSP  180
NTPPIAKVDS FMQFTDKGFD DPSISFGSVE ANGRPGLNLE RSLDHDGHPL AITTVDAVPA  240
NGVPPWNWRE TPGNGGDAHG QPFGGRVITV KFGDYTRRIG VDGTAEAIKE TIRSAFSLRT  300
RRAFWLEDED QVVRCLDRDM PLGNYLLHVD GGVAIRVCHY DESNQLPVHT EEKIFYTEED  360
YRDFLARRGW TYLQVDGFRN IDNMDDLQAG AVYRGVRERM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A1e-5375160186DNA binding protein GT-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.129580.0root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBMTransfer from 920224Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288865.10.0trihelix transcription factor GT-1-like
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLM4DT780.0M4DT78_BRARP; Uncharacterized protein
STRINGBra019721.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28912768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein